(data stored in ACNUC7421 zone)

EMBL: CP001600.PE372

CP001600.PE372       Location/Qualifiers
FT   CDS             409771..410235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0405"
FT                   /product="conserved hypothetical protein TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67643"
FT                   /db_xref="GOA:C5BDM7"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDM7"
FT                   /protein_id="ACR67643.1"
FT                   /translation="MTSIVLQLPDEAATIVLGGALARACQRATVIYLYGDLGAGKTTFS
FT                   RGFLQAMGHQGTVKSPTYTLVEPYPLAPRPVYHFDLYRLADPEELEFMGIRDYFAQDAL
FT                   LLVEWPQQGMGFLPEPDITLHLTYTDGGRQAVIEAHSVHGQGVLAALDGQ"
     MTSIVLQLPD EAATIVLGGA LARACQRATV IYLYGDLGAG KTTFSRGFLQ AMGHQGTVKS        60
     PTYTLVEPYP LAPRPVYHFD LYRLADPEEL EFMGIRDYFA QDALLLVEWP QQGMGFLPEP       120
     DITLHLTYTD GGRQAVIEAH SVHGQGVLAA LDGQ                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page