(data stored in ACNUC7421 zone)

EMBL: CP001600.PE374

CP001600.PE374       Location/Qualifiers
FT   CDS             411900..413819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0407"
FT                   /product="DNA mismatch repair protein MutL, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67645"
FT                   /db_xref="GOA:C5BDM9"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BDM9"
FT                   /protein_id="ACR67645.1"
FT                   /translation="MPIQILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IERGGAKLIRIRDNGGGIGKAELALALARHATSKISTLDDLEAIVSLGFRGEALASISS
FT                   VSRLTMTSRPEGQAEAWQAYAEGREMAVMVKPSAHPVGTTVEVLDLFYNTPARRKFLRT
FT                   EKTEFAHIDEVVRRIALARFDITLTLQHNGKTVRQYRAVKEGDARERRLGAICGPVFVQ
FT                   HALALTWRHDELAIHGWVAAPQAIRQIGELQYCYVNGRMMRDRLITHAIRQAYQDRLSD
FT                   EMPPAYVLYLEIDPRQVDVNVHPAKHEVRFHQARLVHDFIYQAVVEVLQQAQVASAHDD
FT                   PTPAISGAARDEEPRGVENRASAGENRFNRPASSPVASAPRPAHVAAPRMPAGDIFRRR
FT                   EGELYQRLLAANPAPAAETDSAFVAAPGAPVTVAGPPAVAVSTAAENGAPGDSFGRVLT
FT                   LCADGVALTECRSGVALVSLFHARRCLLRAQLQPPDEGLKAQPLLVPLRLTLEAAERQA
FT                   LKTQQPLLQQMGLRLQPERQHALLHAVPLPLRQQNLPRLIPQMLRYLATASVCDAASLA
FT                   DWLAAHWHSADEAPWTVAQAVQLLADLERLCPQLVQSPPRALLQPLDLQPGVDRLRQEE
FT                   QLNE"
     MPIQILPPQL ANQIAAGEVV ERPASVVKEL VENSLDAGAT RIDIDIERGG AKLIRIRDNG        60
     GGIGKAELAL ALARHATSKI STLDDLEAIV SLGFRGEALA SISSVSRLTM TSRPEGQAEA       120
     WQAYAEGREM AVMVKPSAHP VGTTVEVLDL FYNTPARRKF LRTEKTEFAH IDEVVRRIAL       180
     ARFDITLTLQ HNGKTVRQYR AVKEGDARER RLGAICGPVF VQHALALTWR HDELAIHGWV       240
     AAPQAIRQIG ELQYCYVNGR MMRDRLITHA IRQAYQDRLS DEMPPAYVLY LEIDPRQVDV       300
     NVHPAKHEVR FHQARLVHDF IYQAVVEVLQ QAQVASAHDD PTPAISGAAR DEEPRGVENR       360
     ASAGENRFNR PASSPVASAP RPAHVAAPRM PAGDIFRRRE GELYQRLLAA NPAPAAETDS       420
     AFVAAPGAPV TVAGPPAVAV STAAENGAPG DSFGRVLTLC ADGVALTECR SGVALVSLFH       480
     ARRCLLRAQL QPPDEGLKAQ PLLVPLRLTL EAAERQALKT QQPLLQQMGL RLQPERQHAL       540
     LHAVPLPLRQ QNLPRLIPQM LRYLATASVC DAASLADWLA AHWHSADEAP WTVAQAVQLL       600
     ADLERLCPQL VQSPPRALLQ PLDLQPGVDR LRQEEQLNE                              639
//

If you have problems or comments...

PBIL Back to PBIL home page