(data stored in ACNUC7421 zone)

EMBL: CP001600.PE378

CP001600.PE378       Location/Qualifiers
FT   CDS             416674..417933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0411"
FT                   /product="HflK protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67649"
FT                   /db_xref="GOA:C5BDN3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C5BDN3"
FT                   /protein_id="ACR67649.1"
FT                   /translation="MAWNQPGNNGQNRDPWGSSNNNGGNSGGNNNKGGRDQGPPDLDDL
FT                   FRKVSKKLGGLGGGKSGGSGSAGTPRSSIGGKKVVGLAVAAVVVIWAASGFYTIKEAER
FT                   GVVTRFGKFSHLVQPGLNWKPTFIDDVIPVNVESVRELAASGVMLTSDENVVRVEMNVQ
FT                   YRVTNPEEYLFNVTNADDSLRQATDSALRAVIGKYTMDTILTEGRTVIRNDTQKVLEEI
FT                   IRPYHMGITILDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQ
FT                   AQRILEDAKAYKDRTVLEAQGEVGRFSRLLPEYKASPEITRERLYLETMERVLGHTRKV
FT                   LVDDKSNNLMVLPLDQIMRSGDKGASQAGDSKDTSLIRLNPPQASSKPVSAGSSTDSSV
FT                   MDQRRVNAQRNDTTRLGRDY"
     MAWNQPGNNG QNRDPWGSSN NNGGNSGGNN NKGGRDQGPP DLDDLFRKVS KKLGGLGGGK        60
     SGGSGSAGTP RSSIGGKKVV GLAVAAVVVI WAASGFYTIK EAERGVVTRF GKFSHLVQPG       120
     LNWKPTFIDD VIPVNVESVR ELAASGVMLT SDENVVRVEM NVQYRVTNPE EYLFNVTNAD       180
     DSLRQATDSA LRAVIGKYTM DTILTEGRTV IRNDTQKVLE EIIRPYHMGI TILDVNFQAA       240
     RPPEEVKAAF DDAIAARENE QQYIREAEAY ANEVQPRANG QAQRILEDAK AYKDRTVLEA       300
     QGEVGRFSRL LPEYKASPEI TRERLYLETM ERVLGHTRKV LVDDKSNNLM VLPLDQIMRS       360
     GDKGASQAGD SKDTSLIRLN PPQASSKPVS AGSSTDSSVM DQRRVNAQRN DTTRLGRDY        419
//

If you have problems or comments...

PBIL Back to PBIL home page