(data stored in ACNUC7421 zone)

EMBL: CP001600.PE379

CP001600.PE379       Location/Qualifiers
FT   CDS             417933..418937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0412"
FT                   /product="HflC protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67650"
FT                   /db_xref="GOA:C5BF64"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF64"
FT                   /protein_id="ACR67650.1"
FT                   /translation="MRKSLLVILIVVLVALYASLFVVQEGQRGIVLRFGKVLRDDENKP
FT                   LVYAPGLHLKIPFIESVKMLDARIQTMDNQADRFVTKEKKDLIVDSYIKWRISDFSRYY
FT                   LATGGGDVSQAEVLLKRKFSDRLRSEIGRLDIKDIVTDSRGKLMEDVRNALNTGTVDDA
FT                   AAPTEADDAIASAAARVARETSGKQPAVNPNSMAALGIQVVDVRIKQINLPTEVSDAIY
FT                   QRMRAEREAVARRHRSQGQEEAEKLRATADYEVTRTLAEAEREGRIIRGEGDAKAAKLF
FT                   ANAFSKDPDFFAFIRSLKAYENSFKGGQDVMVLRPDSDFFKYMKSPDGGKNAK"
     MRKSLLVILI VVLVALYASL FVVQEGQRGI VLRFGKVLRD DENKPLVYAP GLHLKIPFIE        60
     SVKMLDARIQ TMDNQADRFV TKEKKDLIVD SYIKWRISDF SRYYLATGGG DVSQAEVLLK       120
     RKFSDRLRSE IGRLDIKDIV TDSRGKLMED VRNALNTGTV DDAAAPTEAD DAIASAAARV       180
     ARETSGKQPA VNPNSMAALG IQVVDVRIKQ INLPTEVSDA IYQRMRAERE AVARRHRSQG       240
     QEEAEKLRAT ADYEVTRTLA EAEREGRIIR GEGDAKAAKL FANAFSKDPD FFAFIRSLKA       300
     YENSFKGGQD VMVLRPDSDF FKYMKSPDGG KNAK                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page