(data stored in ACNUC7421 zone)

EMBL: CP001600.PE383

CP001600.PE383       Location/Qualifiers
FT   CDS             complement(422272..422487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67654"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF68"
FT                   /protein_id="ACR67654.1"
FT                   /translation="MYTKARNPKSVKLVNCTNTSIHHAALPAGNEDGSGAQASSSRPSM
FT                   RKMHPARPTHDHRMQRALQRGTPYTG"
     MYTKARNPKS VKLVNCTNTS IHHAALPAGN EDGSGAQASS SRPSMRKMHP ARPTHDHRMQ        60
     RALQRGTPYT G                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page