(data stored in ACNUC7421 zone)

EMBL: CP001600.PE387

CP001600.PE387       Location/Qualifiers
FT   CDS             complement(426212..426487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0420"
FT                   /product="Protein of unknown function (DUF1471)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67658"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF72"
FT                   /protein_id="ACR67658.1"
FT                   /translation="MSRSPLFTSLLFSIGLIGTSAQSAEYARADLVTDLSRMGMISLRG
FT                   ILGNPQDVERSIAHQADQRGARYYRILHMWESDGQQGWQATAALYR"
     MSRSPLFTSL LFSIGLIGTS AQSAEYARAD LVTDLSRMGM ISLRGILGNP QDVERSIAHQ        60
     ADQRGARYYR ILHMWESDGQ QGWQATAALY R                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page