(data stored in ACNUC7421 zone)

EMBL: CP001600.PE389

CP001600.PE389       Location/Qualifiers
FT   CDS             426987..427109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67660"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF74"
FT                   /protein_id="ACR67660.1"
FT                   /translation="MAGKRIVMIILALSDADFPEKRRIVRAEDTGACLRSLAGR"
     MAGKRIVMII LALSDADFPE KRRIVRAEDT GACLRSLAGR                              40
//

If you have problems or comments...

PBIL Back to PBIL home page