(data stored in ACNUC7421 zone)

EMBL: CP001600.PE39

CP001600.PE39        Location/Qualifiers
FT   CDS             34182..34766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0041"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67301"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C1"
FT                   /protein_id="ACR67301.1"
FT                   /translation="MTKQKILIIESRSALDIYDERCEGNTLRQVLELQGVAAKCTEVIN
FT                   KGMLLKALKIAQREHIKYVHISAHGSSDGFTLTDGDSISWKDFDKIAWPILKGKCICFS
FT                   SCSVGRGAEQLFDFHKSFCNAIVGPIRDITWGEGLVAYSAFYHRAQSYEKSSFQDVRVM
FT                   NNIVGAGTFRFIASPYISSTYTIDGSLKQGC"
     MTKQKILIIE SRSALDIYDE RCEGNTLRQV LELQGVAAKC TEVINKGMLL KALKIAQREH        60
     IKYVHISAHG SSDGFTLTDG DSISWKDFDK IAWPILKGKC ICFSSCSVGR GAEQLFDFHK       120
     SFCNAIVGPI RDITWGEGLV AYSAFYHRAQ SYEKSSFQDV RVMNNIVGAG TFRFIASPYI       180
     SSTYTIDGSL KQGC                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page