(data stored in ACNUC7421 zone)

EMBL: CP001600.PE390

CP001600.PE390       Location/Qualifiers
FT   CDS             427142..427891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0423"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67661"
FT                   /db_xref="GOA:C5BF75"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF75"
FT                   /protein_id="ACR67661.2"
FT                   /translation="MVEMFEQTVGGIPLLHAVPAGQRDSALPTIFFYHGFTSSKEMYSY
FT                   FGYAFAAAGFRVLLPEADMHGSRYDGDERRRLAHFWDILKSNIDELPSLYDHFLRAGLI
FT                   LDGRVGVAGASLGGMTALGAKARYPWLRATASFMGSGFYLSLSQRLFPRQHQPTEDERE
FT                   WVRQRVSALADYDVSGRLAQLADRPLLIWHGLADDLVPAAESQRLAQALASHHLMDNVS
FT                   VVTEPGIAHKITASALACGTAFFSRRL"
     MVEMFEQTVG GIPLLHAVPA GQRDSALPTI FFYHGFTSSK EMYSYFGYAF AAAGFRVLLP        60
     EADMHGSRYD GDERRRLAHF WDILKSNIDE LPSLYDHFLR AGLILDGRVG VAGASLGGMT       120
     ALGAKARYPW LRATASFMGS GFYLSLSQRL FPRQHQPTED EREWVRQRVS ALADYDVSGR       180
     LAQLADRPLL IWHGLADDLV PAAESQRLAQ ALASHHLMDN VSVVTEPGIA HKITASALAC       240
     GTAFFSRRL                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page