(data stored in ACNUC7421 zone)

EMBL: CP001600.PE392

CP001600.PE392       Location/Qualifiers
FT   CDS             428495..428890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0425"
FT                   /product="30S ribosomal protein S6, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67663"
FT                   /db_xref="GOA:C5BF77"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BF77"
FT                   /protein_id="ACR67663.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYTGAITGAEGKIHRLEDWGRR
FT                   QLAYSINKLHKAHYVLMNVEASQEVIDELETNFRYNDAVIRSMVMRTKHAVTEASPMVK
FT                   AKDERRERREDFANETSEETEAGDSEE"
     MRHYEIVFMV HPDQSEQVPG MIERYTGAIT GAEGKIHRLE DWGRRQLAYS INKLHKAHYV        60
     LMNVEASQEV IDELETNFRY NDAVIRSMVM RTKHAVTEAS PMVKAKDERR ERREDFANET       120
     SEETEAGDSE E                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page