(data stored in ACNUC7421 zone)

EMBL: CP001600.PE393

CP001600.PE393       Location/Qualifiers
FT   CDS             429221..429448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0426"
FT                   /product="30S ribosomal protein S18, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67664"
FT                   /db_xref="GOA:C5BF78"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BF78"
FT                   /protein_id="ACR67664.1"
FT                   /translation="MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARAIKRARYLSLLPYTDRHQ"
     MARYFRRRKF CRFTAEGVQE IDYKDIATLK NYITESGKIV PSRITGTRAK YQRQLARAIK        60
     RARYLSLLPY TDRHQ                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page