(data stored in ACNUC7421 zone)

EMBL: CP001600.PE394

CP001600.PE394       Location/Qualifiers
FT   CDS             429491..429940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0427"
FT                   /product="50S ribosomal protein L9, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67665"
FT                   /db_xref="GOA:C5BF79"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BF79"
FT                   /protein_id="ACR67665.1"
FT                   /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPMGKAVPATKKNVE
FT                   FFEARRADLEAKLAETLSAAEARAVKINELATVTIASKAGDEGKLFGSIGTRDIADAVT
FT                   AAGVAVTKSEVRLPNGVLRTLGDHEVHFQVHSDVFAQLNVVVVAE"
     MQVILLDKVA NLGSLGDQVN VKAGYARNFL VPMGKAVPAT KKNVEFFEAR RADLEAKLAE        60
     TLSAAEARAV KINELATVTI ASKAGDEGKL FGSIGTRDIA DAVTAAGVAV TKSEVRLPNG       120
     VLRTLGDHEV HFQVHSDVFA QLNVVVVAE                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page