(data stored in ACNUC7421 zone)

EMBL: CP001600.PE395

CP001600.PE395       Location/Qualifiers
FT   CDS             430155..430523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0429"
FT                   /product="Protein of unknown function, DUF488"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67667"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF80"
FT                   /protein_id="ACR67667.1"
FT                   /translation="MVSIGLQRVYDVWAPCSPHTFLTDRLWPRGIAKARLDGVHWLKEV
FT                   APSTALRQAFHHAQLDWPAFVARYREELAANPRAWQSLVQLLCQGESLTLLYGSRDSQC
FT                   NQAVALRDWLLEQLIAGE"
     MVSIGLQRVY DVWAPCSPHT FLTDRLWPRG IAKARLDGVH WLKEVAPSTA LRQAFHHAQL        60
     DWPAFVARYR EELAANPRAW QSLVQLLCQG ESLTLLYGSR DSQCNQAVAL RDWLLEQLIA       120
     GE                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page