(data stored in ACNUC7421 zone)

EMBL: CP001600.PE398

CP001600.PE398       Location/Qualifiers
FT   CDS             complement(432073..432738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0431"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67669"
FT                   /db_xref="GOA:C5BF83"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="InterPro:IPR023742"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BF83"
FT                   /protein_id="ACR67669.1"
FT                   /translation="MTYRDRPLGELAISIPRATRLFRQYELDFCCGGKLTLQRAAARHS
FT                   LDLVMLESQLAELDSTPDQHRDWRQAPLDELCAFIVTRYHQRHRDQLPELVLMAQKVEQ
FT                   VHTGKTGCPRGLAKQLDSLRQELDSHMMKEERILFPLIEQGEGARCHGPISVMEHEHRD
FT                   AGELLDVIRFLTDNMTPPTGACTTWRALYAGISELINDLMEHVSLENNLLFPRALGDV"
     MTYRDRPLGE LAISIPRATR LFRQYELDFC CGGKLTLQRA AARHSLDLVM LESQLAELDS        60
     TPDQHRDWRQ APLDELCAFI VTRYHQRHRD QLPELVLMAQ KVEQVHTGKT GCPRGLAKQL       120
     DSLRQELDSH MMKEERILFP LIEQGEGARC HGPISVMEHE HRDAGELLDV IRFLTDNMTP       180
     PTGACTTWRA LYAGISELIN DLMEHVSLEN NLLFPRALGD V                           221
//

If you have problems or comments...

PBIL Back to PBIL home page