(data stored in ACNUC7421 zone)

EMBL: CP001600.PE4

CP001600.PE4         Location/Qualifiers
FT   CDS             3773..6187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0004"
FT                   /product="DNA gyrase, B subunit, putative"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67266"
FT                   /db_xref="GOA:C5BHC8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHC8"
FT                   /protein_id="ACR67266.1"
FT                   /translation="MSNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGYCKDIIVTIHSDNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLELVIRRDGHVHEQIYRHGVPAAPLKVVGDTDLT
FT                   GTRVRFWPSMETFSNVVEFQYDILAKRLRELSFLNSGVSIRLCDKRNDREDHFHYEGGI
FT                   KAFVEYLNKNKTPIHPNVFYFSTMKDDIGVEVALQWNDGFQENIYCFTNNIPQRDGGTH
FT                   LAGFRAAMTRTLNSYMENEGYTKKSKISATGDDAREGLIAVVSVKVPDPKFSSQTKDKL
FT                   VSSEVKSAVESLMNERLAEYLLENPSDAKIVVGKIIDAARAREAARKAREMTRRKGALD
FT                   LAGLPGKLADCQERDPAHSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPEIIERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQMSIALDGAALHINAAAPALA
FT                   GEPLEKLVAEYYQAQKLIGRMERRYPKAVLNQLIYQPTLSDADLGNQAQVEQWINSLVA
FT                   TLNEKELHGSVYSARALENRERQMFEPLVRVRTHGVDTDYGFDFDFVHGAEYRRICALG
FT                   EKLRDLLEESAFVERGERRQPVASFEQALDWLVKESRRGLAIQRYKGLGEMNPDQLWET
FT                   TMDPEGRRMLRVTIKDAVAADQLFTTLMGDAVEPRRAFIEENALKASNLDF"
     MSNTYDSSSI KVLKGLDAVR KRPGMYIGDT DDGTGLHHMV FEVVDNAIDE ALAGYCKDII        60
     VTIHSDNSVS VQDDGRGIPT GIHPEEGVSA AEVIMTVLHA GGKFDDNSYK VSGGLHGVGV       120
     SVVNALSEKL ELVIRRDGHV HEQIYRHGVP AAPLKVVGDT DLTGTRVRFW PSMETFSNVV       180
     EFQYDILAKR LRELSFLNSG VSIRLCDKRN DREDHFHYEG GIKAFVEYLN KNKTPIHPNV       240
     FYFSTMKDDI GVEVALQWND GFQENIYCFT NNIPQRDGGT HLAGFRAAMT RTLNSYMENE       300
     GYTKKSKISA TGDDAREGLI AVVSVKVPDP KFSSQTKDKL VSSEVKSAVE SLMNERLAEY       360
     LLENPSDAKI VVGKIIDAAR AREAARKARE MTRRKGALDL AGLPGKLADC QERDPAHSEL       420
     YLVEGDSAGG SAKQGRNRKN QAILPLKGKI LNVEKARFDK MLSSQEVATL ITALGCGIGR       480
     DEYNPDKLRY HSIIIMTDAD VDGSHIRTLL LTFFYRQMPE IIERGHVYIA QPPLYKVKKG       540
     KQEQYIKDDE AMDQYQMSIA LDGAALHINA AAPALAGEPL EKLVAEYYQA QKLIGRMERR       600
     YPKAVLNQLI YQPTLSDADL GNQAQVEQWI NSLVATLNEK ELHGSVYSAR ALENRERQMF       660
     EPLVRVRTHG VDTDYGFDFD FVHGAEYRRI CALGEKLRDL LEESAFVERG ERRQPVASFE       720
     QALDWLVKES RRGLAIQRYK GLGEMNPDQL WETTMDPEGR RMLRVTIKDA VAADQLFTTL       780
     MGDAVEPRRA FIEENALKAS NLDF                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page