(data stored in ACNUC7421 zone)

EMBL: CP001600.PE40

CP001600.PE40        Location/Qualifiers
FT   CDS             35203..35634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0042"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67302"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C2"
FT                   /protein_id="ACR67302.1"
FT                   /translation="MAEINKATLTEADIISKYLLPAIKAAGWDDLTQIRQEVKLRDGKV
FT                   VVRGQMAARKKVKSADIVLYHKMGLPLAVIEAKANKHEIGKGMQQGLDYARLLDVPFVF
FT                   SSNGDGFVFHDKTNPATLESEIALEDFPSPGQLWDKLCT"
     MAEINKATLT EADIISKYLL PAIKAAGWDD LTQIRQEVKL RDGKVVVRGQ MAARKKVKSA        60
     DIVLYHKMGL PLAVIEAKAN KHEIGKGMQQ GLDYARLLDV PFVFSSNGDG FVFHDKTNPA       120
     TLESEIALED FPSPGQLWDK LCT                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page