(data stored in ACNUC7421 zone)

EMBL: CP001600.PE401

CP001600.PE401       Location/Qualifiers
FT   CDS             434037..434243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0434"
FT                   /product="Protein of unknown function (DUF1107)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67672"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF86"
FT                   /protein_id="ACR67672.1"
FT                   /translation="MKIFQRYNPLLVAKYVKTLFRGRLYIQGVGAFEFDMGRILLPKVK
FT                   DKRHLSVMSEINRQVLRLQAEMS"
     MKIFQRYNPL LVAKYVKTLF RGRLYIQGVG AFEFDMGRIL LPKVKDKRHL SVMSEINRQV        60
     LRLQAEMS                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page