(data stored in ACNUC7421 zone)

EMBL: CP001600.PE402

CP001600.PE402       Location/Qualifiers
FT   CDS             complement(434292..435638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0435"
FT                   /product="hypothetical protein"
FT                   /note="Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67673"
FT                   /db_xref="GOA:C5BF87"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF87"
FT                   /protein_id="ACR67673.1"
FT                   /translation="MLNSILLIILLIAISAFFSISEISLAASRKIKLKTMADEGDINAA
FT                   RVMALQDQPGYFFTVVQIGLNAVAILGGIVGDAAFSPAFRLLFDRFMPLEVSQQASFIC
FT                   SFVLVTSCFILFADLTPKRIGMIAPEAVAVRIVNPMRFCLLLFRPLVWFFNGLANLIFH
FT                   LFKIPMVRKDDITPDDIYAVVEAGALAGVLRKQEHEIIENVFELESRTVPSSMTPRENI
FT                   IYFDLGETEDSIKEKVSTHPHSKFLVCDGAIDHVVGYVDSKDLLNRVLGNQSLVLSSGV
FT                   QIRNVLIVPDTLTLSEALESFKNAGEDFAIILNEYALVVGVITLNDVMTTLMGDLVGQG
FT                   QEEQIIARDENSWLVEGVTPIDDVMRVLDIEEFPQSSNYETIGGFMMYMLRKIPKRTDA
FT                   VKYAGYKFEVVDIDSYKIDQLLVTRLAERLPPMSPDAGDDADVPQQAAK"
     MLNSILLIIL LIAISAFFSI SEISLAASRK IKLKTMADEG DINAARVMAL QDQPGYFFTV        60
     VQIGLNAVAI LGGIVGDAAF SPAFRLLFDR FMPLEVSQQA SFICSFVLVT SCFILFADLT       120
     PKRIGMIAPE AVAVRIVNPM RFCLLLFRPL VWFFNGLANL IFHLFKIPMV RKDDITPDDI       180
     YAVVEAGALA GVLRKQEHEI IENVFELESR TVPSSMTPRE NIIYFDLGET EDSIKEKVST       240
     HPHSKFLVCD GAIDHVVGYV DSKDLLNRVL GNQSLVLSSG VQIRNVLIVP DTLTLSEALE       300
     SFKNAGEDFA IILNEYALVV GVITLNDVMT TLMGDLVGQG QEEQIIARDE NSWLVEGVTP       360
     IDDVMRVLDI EEFPQSSNYE TIGGFMMYML RKIPKRTDAV KYAGYKFEVV DIDSYKIDQL       420
     LVTRLAERLP PMSPDAGDDA DVPQQAAK                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page