(data stored in ACNUC7421 zone)

EMBL: CP001600.PE403

CP001600.PE403       Location/Qualifiers
FT   CDS             complement(435912..436550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0436"
FT                   /product="Peptide methionine-S-oxide reductase, putative"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67674"
FT                   /db_xref="GOA:C5BF88"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF88"
FT                   /protein_id="ACR67674.1"
FT                   /translation="MHHHNSSTPAPFTPAQALPGRTQAMSLSGKHALNGHDMYAIPAGM
FT                   EEALFAMGCFWGVERLFWQQPGIYSTAAGYSGGLTPNPTYREVCSGQTGHAETVRVVFD
FT                   PSLIRYDDLLRLFWQHHDPAQGMRQGNDVGTQYRSALFPVTSQQMQAAQASHTRFAQAM
FT                   HQVGDLRPISTEIRAAGPFYYAEEEHQQYLHKHPHGYCGVGGIGVCLPD"
     MHHHNSSTPA PFTPAQALPG RTQAMSLSGK HALNGHDMYA IPAGMEEALF AMGCFWGVER        60
     LFWQQPGIYS TAAGYSGGLT PNPTYREVCS GQTGHAETVR VVFDPSLIRY DDLLRLFWQH       120
     HDPAQGMRQG NDVGTQYRSA LFPVTSQQMQ AAQASHTRFA QAMHQVGDLR PISTEIRAAG       180
     PFYYAEEEHQ QYLHKHPHGY CGVGGIGVCL PD                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page