(data stored in ACNUC7421 zone)

EMBL: CP001600.PE404

CP001600.PE404       Location/Qualifiers
FT   CDS             436833..438569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0437"
FT                   /product="outer membrane protein, OMP85 family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67675"
FT                   /db_xref="GOA:C5BF89"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF89"
FT                   /protein_id="ACR67675.1"
FT                   /translation="MPRLRRIGLLCLLLAAPLAHAAQVRLVVEGLSGQLQQNVRATLST
FT                   IGEDEISNDGRFRVRAADAIRQGLRALGYFQPTIEFEYRPGSIFSRPQLIANVTPGEPV
FT                   RIAGLNVRIRGAAKDDSAYQALLAKSLPPVGSVLDQGDYDNLKNALNSLALQRGYFSAT
FT                   MPVHQLGVIEDQHKAFWDIEFDSGPRYRFGDVRFSGSQIQTAYLQNLRPFKSGEYYSAD
FT                   DLAKFSGNLSATNWFNSVVVSPDFKALGTDQTLPLQAVVTPRSQNMVDLGGGYATDVGP
FT                   RMKVSWKRPWMNSYGHSLDTSLNLSMPEQTADFSYKIPLLKAPLEQYYLVQGGFQRTDL
FT                   NDTQSDSTTLNLARYWELSSGWQRGINMRWGLDHFTQGNVTETAMLLYPGVSVNRTRSR
FT                   GGLMPSWGDTQRYSMDVSNRYWGSSVDFVVFQAQNVWIRTLAERHRFVVRGDLGWIETN
FT                   DFNKVPPSLRFFAGGDRSIRGYKYKSISPKGSDGKLTGASRLATGSLEYQYNLSGKWWG
FT                   GVFIDSGEAVNDFTKSDFHTGTGVGVIWVSPVGPIRLNLGVPVGREDKHDVQIYIGLGP
FT                   EL"
     MPRLRRIGLL CLLLAAPLAH AAQVRLVVEG LSGQLQQNVR ATLSTIGEDE ISNDGRFRVR        60
     AADAIRQGLR ALGYFQPTIE FEYRPGSIFS RPQLIANVTP GEPVRIAGLN VRIRGAAKDD       120
     SAYQALLAKS LPPVGSVLDQ GDYDNLKNAL NSLALQRGYF SATMPVHQLG VIEDQHKAFW       180
     DIEFDSGPRY RFGDVRFSGS QIQTAYLQNL RPFKSGEYYS ADDLAKFSGN LSATNWFNSV       240
     VVSPDFKALG TDQTLPLQAV VTPRSQNMVD LGGGYATDVG PRMKVSWKRP WMNSYGHSLD       300
     TSLNLSMPEQ TADFSYKIPL LKAPLEQYYL VQGGFQRTDL NDTQSDSTTL NLARYWELSS       360
     GWQRGINMRW GLDHFTQGNV TETAMLLYPG VSVNRTRSRG GLMPSWGDTQ RYSMDVSNRY       420
     WGSSVDFVVF QAQNVWIRTL AERHRFVVRG DLGWIETNDF NKVPPSLRFF AGGDRSIRGY       480
     KYKSISPKGS DGKLTGASRL ATGSLEYQYN LSGKWWGGVF IDSGEAVNDF TKSDFHTGTG       540
     VGVIWVSPVG PIRLNLGVPV GREDKHDVQI YIGLGPEL                               578
//

If you have problems or comments...

PBIL Back to PBIL home page