(data stored in ACNUC7421 zone)

EMBL: CP001600.PE405

CP001600.PE405       Location/Qualifiers
FT   CDS             438566..442330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0438"
FT                   /product="Protein of unknown function (DUF490)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67676"
FT                   /db_xref="GOA:C5BF90"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF90"
FT                   /protein_id="ACR67676.1"
FT                   /translation="MRWYNIRRYALMLLLGLLLLLALLLGGVMTQGGLHLALNAAARWV
FT                   PGLEIGRVEGGWRDLTLRDVGYRMPGVDVAVGQFHLSLDIGCLKRSELCLNVLSAQRVR
FT                   VNVDTQALPPSEPPTTPSAPLGRLATPYPLVLRLLRLNDVQVNVDGTAISLEALRSGAE
FT                   WRGSLLRLQPSDIQGLRVSLPPPAAPAPAESAAPKGPSEPLGEVLTALFSRPLLPAAMT
FT                   LDLPLDMQLSRISARQVQIRAATDLDIASLELRAALDQQRLALHTLKVQAQQGSLSARG
FT                   SATFSGRWPLDLQLNASVNQAPLKGEKLRLALKGAMYDTLALDANLSGPLRATLKGDTR
FT                   LADAGLPLSLSLDSPSLRWPLGGTPDYQVNNMVLRLTGSAHDYRLQLRGAFSGQGLPDA
FT                   ALDLAGKGNERQFTLSQLQLATLGGKADMQALVDWSKAISWRSSLTLTGIDTGRQWPAW
FT                   PSSLNGKIETRGSLYGGSWQLQVPQLKLTGRIKQNGLDVGGQLRGNQAGQWQIPQLHIA
FT                   LGRNRIEVNGDLAQKQWSLDGRIDAPRLDGTLPGLSGSARGTLKLRGDRQAPQLLADLQ
FT                   ARGLRWQDLTIQRVALLGDIRSDQQIQGTLDLRVDSLKQGDIDISQLTLRAAGNERQHR
FT                   LQLVMQGTPLAGRLTLNGSLAQDRARWSGTLTDTDFTTPVGEWRLTRPIALEYGVAKQQ
FT                   MAIGPHCWDNPNARLCVPQTIEVGESGKVSVVLERFDLAMLQPFLGPDTQLHGRFSGRA
FT                   QASWQAGQGLPQARITLNGDGVRVVQQVQGNTLPVALSTVTLEASLAQGQARVNWLIGI
FT                   VDNGQLRGDVRIANLEGARNLSGNVDIQHLSLALFNPALMKGEKAQGMLNASLRLGGST
FT                   LHPQLYGRLALDGVDIDGQFMPFDVTDANLAINFDGMSSVLQGVIKTSQGQLNLSGNAD
FT                   WRNLNAWRARIAASGTRLRVTVPPMVRLDVSPNIVFDASPSQLALSGWVDIPWARITVQ
FT                   ELPESAVGVSSDEVMLNNAHQPIRPVTASIPLHTDLTIAIGNNVRLSAFGLKAALKGEL
FT                   KVSQNQNGLGLNGQIMIPQGRFAAYGQDLLIRQGELVFAGPPGNPLLNIEAIRNPESTA
FT                   NDVTVGVRVTGLAEQPKLEVFSDPAMSQQEALSYLLRGQGLNSSGADSNAMTSMLIGLG
FT                   VAQSGKLVGKIGETFGVSNLTLDSQGVGDSSQVVVSGYVLPGLQVKYGMGIFDSLATLT
FT                   LRYRLMPNLYLEAVSGVNQALDLLYQFEF"
     MRWYNIRRYA LMLLLGLLLL LALLLGGVMT QGGLHLALNA AARWVPGLEI GRVEGGWRDL        60
     TLRDVGYRMP GVDVAVGQFH LSLDIGCLKR SELCLNVLSA QRVRVNVDTQ ALPPSEPPTT       120
     PSAPLGRLAT PYPLVLRLLR LNDVQVNVDG TAISLEALRS GAEWRGSLLR LQPSDIQGLR       180
     VSLPPPAAPA PAESAAPKGP SEPLGEVLTA LFSRPLLPAA MTLDLPLDMQ LSRISARQVQ       240
     IRAATDLDIA SLELRAALDQ QRLALHTLKV QAQQGSLSAR GSATFSGRWP LDLQLNASVN       300
     QAPLKGEKLR LALKGAMYDT LALDANLSGP LRATLKGDTR LADAGLPLSL SLDSPSLRWP       360
     LGGTPDYQVN NMVLRLTGSA HDYRLQLRGA FSGQGLPDAA LDLAGKGNER QFTLSQLQLA       420
     TLGGKADMQA LVDWSKAISW RSSLTLTGID TGRQWPAWPS SLNGKIETRG SLYGGSWQLQ       480
     VPQLKLTGRI KQNGLDVGGQ LRGNQAGQWQ IPQLHIALGR NRIEVNGDLA QKQWSLDGRI       540
     DAPRLDGTLP GLSGSARGTL KLRGDRQAPQ LLADLQARGL RWQDLTIQRV ALLGDIRSDQ       600
     QIQGTLDLRV DSLKQGDIDI SQLTLRAAGN ERQHRLQLVM QGTPLAGRLT LNGSLAQDRA       660
     RWSGTLTDTD FTTPVGEWRL TRPIALEYGV AKQQMAIGPH CWDNPNARLC VPQTIEVGES       720
     GKVSVVLERF DLAMLQPFLG PDTQLHGRFS GRAQASWQAG QGLPQARITL NGDGVRVVQQ       780
     VQGNTLPVAL STVTLEASLA QGQARVNWLI GIVDNGQLRG DVRIANLEGA RNLSGNVDIQ       840
     HLSLALFNPA LMKGEKAQGM LNASLRLGGS TLHPQLYGRL ALDGVDIDGQ FMPFDVTDAN       900
     LAINFDGMSS VLQGVIKTSQ GQLNLSGNAD WRNLNAWRAR IAASGTRLRV TVPPMVRLDV       960
     SPNIVFDASP SQLALSGWVD IPWARITVQE LPESAVGVSS DEVMLNNAHQ PIRPVTASIP      1020
     LHTDLTIAIG NNVRLSAFGL KAALKGELKV SQNQNGLGLN GQIMIPQGRF AAYGQDLLIR      1080
     QGELVFAGPP GNPLLNIEAI RNPESTANDV TVGVRVTGLA EQPKLEVFSD PAMSQQEALS      1140
     YLLRGQGLNS SGADSNAMTS MLIGLGVAQS GKLVGKIGET FGVSNLTLDS QGVGDSSQVV      1200
     VSGYVLPGLQ VKYGMGIFDS LATLTLRYRL MPNLYLEAVS GVNQALDLLY QFEF            1254
//

If you have problems or comments...

PBIL Back to PBIL home page