(data stored in ACNUC7421 zone)

EMBL: CP001600.PE406

CP001600.PE406       Location/Qualifiers
FT   CDS             442387..442677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0439"
FT                   /product="AIG2-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67677"
FT                   /db_xref="GOA:C5BF91"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF91"
FT                   /protein_id="ACR67677.1"
FT                   /translation="MTNATWLGDYVLDGYDLYDLGHYPAVVPGEGRVYCEVYRITSSIL
FT                   AELDELKSNSKDYRRELIKTPYGCAWIYIYLNGVEGLPRIASGDWLKREEG"
     MTNATWLGDY VLDGYDLYDL GHYPAVVPGE GRVYCEVYRI TSSILAELDE LKSNSKDYRR        60
     ELIKTPYGCA WIYIYLNGVE GLPRIASGDW LKREEG                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page