(data stored in ACNUC7421 zone)

EMBL: CP001600.PE41

CP001600.PE41        Location/Qualifiers
FT   CDS             35773..37653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0043"
FT                   /product="type III restriction enzyme, res subunit,
FT                   premature stop"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67303"
FT                   /db_xref="GOA:C5B9C3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C3"
FT                   /protein_id="ACR67303.1"
FT                   /translation="MLVMATGTGKTYTAFQIIWRLWKAGAKKRILFLADRNILVDQAKI
FT                   NDFQPFGPAMTKVSGRTIDPAYEIHLALYQALTGPEESQKAFKQVSPDFFDLIVVDECH
FT                   RGSAAEDSAWREILEYFSSATQIGLTATPKETETVSSTDYFGDPVYTYSLKEGIEDGFL
FT                   APYKVVRVDIDVDLQGWRPTKGQRDKQGNLIEDRIYNQKDFDHTLVIDERTQLVAETIT
FT                   NYLRKTDPMAKTIVFCNDIDHADRMRRALVNLNPEQMAKDERYVMKITGDDDLGKAQLD
FT                   NFINPKKPYPVIATTSELMTTGVDAKTCKLVVLDQNIQSMTKFKQIIGRGTRIDDKYGK
FT                   LWFTILDFKKATELFADPRFDGEPERVMVVTPADINNPDDGLGDIIDGADPLPADESGD
FT                   HGDPFAPGVDEQPGSYTTVNGAGGQGTGPLGGPEPGVSRYYVNGVAVSVIAERVQYYDA
FT                   DGKLVTESFKDYTKKTLLKEFATLDAFTKRWQGAERKQAIMDELAQAGVLWEVLEQEVG
FT                   KELDPFDLICHVVYDQPPLTRRERANNVKKRNYFTKYNDTAQQVLTSLLDKYADQGVTE
FT                   IETKDALKVAPFTELGRPLELAKKGFGGPKQFEQAITELEQEIYREQQSA"
     MLVMATGTGK TYTAFQIIWR LWKAGAKKRI LFLADRNILV DQAKINDFQP FGPAMTKVSG        60
     RTIDPAYEIH LALYQALTGP EESQKAFKQV SPDFFDLIVV DECHRGSAAE DSAWREILEY       120
     FSSATQIGLT ATPKETETVS STDYFGDPVY TYSLKEGIED GFLAPYKVVR VDIDVDLQGW       180
     RPTKGQRDKQ GNLIEDRIYN QKDFDHTLVI DERTQLVAET ITNYLRKTDP MAKTIVFCND       240
     IDHADRMRRA LVNLNPEQMA KDERYVMKIT GDDDLGKAQL DNFINPKKPY PVIATTSELM       300
     TTGVDAKTCK LVVLDQNIQS MTKFKQIIGR GTRIDDKYGK LWFTILDFKK ATELFADPRF       360
     DGEPERVMVV TPADINNPDD GLGDIIDGAD PLPADESGDH GDPFAPGVDE QPGSYTTVNG       420
     AGGQGTGPLG GPEPGVSRYY VNGVAVSVIA ERVQYYDADG KLVTESFKDY TKKTLLKEFA       480
     TLDAFTKRWQ GAERKQAIMD ELAQAGVLWE VLEQEVGKEL DPFDLICHVV YDQPPLTRRE       540
     RANNVKKRNY FTKYNDTAQQ VLTSLLDKYA DQGVTEIETK DALKVAPFTE LGRPLELAKK       600
     GFGGPKQFEQ AITELEQEIY REQQSA                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page