(data stored in ACNUC7421 zone)

EMBL: CP001600.PE410

CP001600.PE410       Location/Qualifiers
FT   CDS             complement(446022..446186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0443"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67681"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C5BF95"
FT                   /protein_id="ACR67681.1"
FT                   /translation="MQPMGVITVSKLGGSIADIDQQLAAKAQPQGASTFRIIEKRIDGN
FT                   YHATAMIYH"
     MQPMGVITVS KLGGSIADID QQLAAKAQPQ GASTFRIIEK RIDGNYHATA MIYH              54
//

If you have problems or comments...

PBIL Back to PBIL home page