(data stored in ACNUC7421 zone)

EMBL: CP001600.PE416

CP001600.PE416       Location/Qualifiers
FT   CDS             450319..450630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0449"
FT                   /product="50S ribosomal protein L21, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67687"
FT                   /db_xref="GOA:C5BFA1"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA1"
FT                   /protein_id="ACR67687.2"
FT                   /translation="MYAVFQSGGKQHRVSEGQTVRLEKLDIATGETVEFDQILMVANGE
FT                   DIKIGVPFVAGGKIKAEVVAHGRGEKVKIVKFRRRKHHRKQQGHRQWFTDVKITGISA"
     MYAVFQSGGK QHRVSEGQTV RLEKLDIATG ETVEFDQILM VANGEDIKIG VPFVAGGKIK        60
     AEVVAHGRGE KVKIVKFRRR KHHRKQQGHR QWFTDVKITG ISA                         103
//

If you have problems or comments...

PBIL Back to PBIL home page