(data stored in ACNUC7421 zone)

EMBL: CP001600.PE417

CP001600.PE417       Location/Qualifiers
FT   CDS             450649..450906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0450"
FT                   /product="50S ribosomal protein L27, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67688"
FT                   /db_xref="GOA:C5BFA2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BFA2"
FT                   /protein_id="ACR67688.1"
FT                   /translation="MAHKKAGGSSRNGRDSESKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGSNVGCGRDHTLFALADGKVKFEVKGPKNRKFISIVAE"
     MAHKKAGGSS RNGRDSESKR LGVKRFGGES VLAGSIIVRQ RGTKFHAGSN VGCGRDHTLF        60
     ALADGKVKFE VKGPKNRKFI SIVAE                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page