(data stored in ACNUC7421 zone)

EMBL: CP001600.PE418

CP001600.PE418       Location/Qualifiers
FT   CDS             450988..451929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0451"
FT                   /product="Integral membrane protein DUF6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67689"
FT                   /db_xref="GOA:C5BFA3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA3"
FT                   /protein_id="ACR67689.1"
FT                   /translation="MSMESKQSAALGIALALTTAIFWGALPIAIKQLLPDMAPETIVWY
FT                   RFSMAALGLGSVLCLRGQLPPLRVFRQRRWLLLLSVATVGLLGNFILFSTSLQYLSPTT
FT                   SQVIGQLSPVGLMFASVLVLKERMRPAQVIGAALLIGGLLLFFNTSLAEIFTRLTDYTL
FT                   GVLLGVAAAGVWVCYGIGQKVLLRRLASQQILCLLYALCAICLWPLAQPGQIYQLSGWQ
FT                   LLCLLFCGINTLVGYGALAEAMVRWQVAKVGAIVTLTPLFTLMFSDILALAWPETFMTP
FT                   SLNVVGYIGAFVVVAGAMFSATGHRWWPRQRT"
     MSMESKQSAA LGIALALTTA IFWGALPIAI KQLLPDMAPE TIVWYRFSMA ALGLGSVLCL        60
     RGQLPPLRVF RQRRWLLLLS VATVGLLGNF ILFSTSLQYL SPTTSQVIGQ LSPVGLMFAS       120
     VLVLKERMRP AQVIGAALLI GGLLLFFNTS LAEIFTRLTD YTLGVLLGVA AAGVWVCYGI       180
     GQKVLLRRLA SQQILCLLYA LCAICLWPLA QPGQIYQLSG WQLLCLLFCG INTLVGYGAL       240
     AEAMVRWQVA KVGAIVTLTP LFTLMFSDIL ALAWPETFMT PSLNVVGYIG AFVVVAGAMF       300
     SATGHRWWPR QRT                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page