(data stored in ACNUC7421 zone)

EMBL: CP001600.PE419

CP001600.PE419       Location/Qualifiers
FT   CDS             451978..453156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0452"
FT                   /product="GTP-binding protein Obg/CgtA , putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67690"
FT                   /db_xref="GOA:C5BFA4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA4"
FT                   /protein_id="ACR67690.1"
FT                   /translation="MKFVDEAVIHIEAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDV
FT                   YLLADENLNTLIDYRFEKSFRAERGQNGQSRDCTGKRGQDVTIKVPVGTRITDVDTGEV
FT                   LGDMTRHQQKLMVGKGGWHGLGNTRFKSSVNRTPRQKTNGTPGDKRDLSLELLLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVRMDSEKSFVVADIPGLIEGAS
FT                   EGAGLGIRFLRHLERCRVLLHLIDLAPIDESDPVENARVIIGELEKYSEKLFQKPRWLV
FT                   FNKADLLAPEEAKARAQAIADALGWEGEHYLISAANREGVNALCWDVMNFLEAHPREAE
FT                   VEEEKEKAKKAEFMWDDYHREQLEQAEAEWEEEDDDDWDEDDDEGVEIIYQR"
     MKFVDEAVIH IEAGDGGNGC VSFRREKYIP KGGPDGGDGG DGGDVYLLAD ENLNTLIDYR        60
     FEKSFRAERG QNGQSRDCTG KRGQDVTIKV PVGTRITDVD TGEVLGDMTR HQQKLMVGKG       120
     GWHGLGNTRF KSSVNRTPRQ KTNGTPGDKR DLSLELLLLA DVGMLGLPNA GKSTFIRAVS       180
     AAKPKVADYP FTTLVPSLGV VRMDSEKSFV VADIPGLIEG ASEGAGLGIR FLRHLERCRV       240
     LLHLIDLAPI DESDPVENAR VIIGELEKYS EKLFQKPRWL VFNKADLLAP EEAKARAQAI       300
     ADALGWEGEH YLISAANREG VNALCWDVMN FLEAHPREAE VEEEKEKAKK AEFMWDDYHR       360
     EQLEQAEAEW EEEDDDDWDE DDDEGVEIIY QR                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page