(data stored in ACNUC7421 zone)

EMBL: CP001600.PE42

CP001600.PE42        Location/Qualifiers
FT   CDS             37774..39261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0044"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67304"
FT                   /db_xref="GOA:C5B9C4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C4"
FT                   /protein_id="ACR67304.1"
FT                   /translation="MSSISSVIKSIQDIMRKDAGIDGDAQRLGQLSWLLFLKVFDAQEE
FT                   ELEFEQDNYRCPIPERFLWRNWAADSEGLTGDALLDFVNNDLFDSLKNQPANIDLNPRG
FT                   YVVKEAFSDAFNYMKNGTLLKQVINKLNEIDFTDSSERHLFGDIYEQILRDLQSAGNAG
FT                   EFYTPRAVTRFMVNRIDPKLGERVMDPACGTGGFLACAFDHVKEHYVETAADHQTLQQQ
FT                   ILGVEKKQLPHLLCTTNMLLHGIEVPVQIRHGNTLDKPLSSWDSDIDVILTNPPFGGTE
FT                   EDGIEQNFPADLRTRETADLFLQLIIEALKKGGRAAVVLPDGTLFGEGVKTKIKQLLTS
FT                   ECNLHTIVRLPNGVFAPYTGIKTNILFFTKGQPTQDVWFYQHPYPAGVKSYSKTKPMKF
FT                   EEFEAEIAWWGDEADGFAARVENEQAWKVSIETIIERNFNLDIKNPHVGEQISHDPDEL
FT                   LARYATEQAEIQILRDQLKTILGDALGKGTAKQEGQA"
     MSSISSVIKS IQDIMRKDAG IDGDAQRLGQ LSWLLFLKVF DAQEEELEFE QDNYRCPIPE        60
     RFLWRNWAAD SEGLTGDALL DFVNNDLFDS LKNQPANIDL NPRGYVVKEA FSDAFNYMKN       120
     GTLLKQVINK LNEIDFTDSS ERHLFGDIYE QILRDLQSAG NAGEFYTPRA VTRFMVNRID       180
     PKLGERVMDP ACGTGGFLAC AFDHVKEHYV ETAADHQTLQ QQILGVEKKQ LPHLLCTTNM       240
     LLHGIEVPVQ IRHGNTLDKP LSSWDSDIDV ILTNPPFGGT EEDGIEQNFP ADLRTRETAD       300
     LFLQLIIEAL KKGGRAAVVL PDGTLFGEGV KTKIKQLLTS ECNLHTIVRL PNGVFAPYTG       360
     IKTNILFFTK GQPTQDVWFY QHPYPAGVKS YSKTKPMKFE EFEAEIAWWG DEADGFAARV       420
     ENEQAWKVSI ETIIERNFNL DIKNPHVGEQ ISHDPDELLA RYATEQAEIQ ILRDQLKTIL       480
     GDALGKGTAK QEGQA                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page