(data stored in ACNUC7421 zone)

EMBL: CP001600.PE420

CP001600.PE420       Location/Qualifiers
FT   CDS             complement(453206..454279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0453"
FT                   /product="two-component signal transduction histidine
FT                   kinase, putative"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67691"
FT                   /db_xref="GOA:C5BFA5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA5"
FT                   /protein_id="ACR67691.1"
FT                   /translation="MISLRRTLLIMLALILLVTQLVSALWLWHESREQISFLVNETLST
FT                   KVRTEQVDKEIHAAIAALLIPSLVMMAVTLLLSWLAVSWIVRPLNQLQARLEKRSPSNL
FT                   TPIDIDSSMTEITSITRTLNHLFSRLQHTLRQERLFTADAAHELRTPLAGVRLHLELME
FT                   QSGVQEATMLVQRIDQLMHTVEQLLMLSRVGQNFASGHYPQLELINEVVLAQRSELCEM
FT                   LALRGQHLRLETPSQIPMHGDAMLLRLMLRNLVENAHRYSPEGSDILLRVTLSTDGHGS
FT                   ILQVIDRGPGIDESRASELTEPFHRLDRRFGGSGLGLNIVVRILQLHKGQLTLRNNRPG
FT                   PGLNACCYLPLTPQDFG"
     MISLRRTLLI MLALILLVTQ LVSALWLWHE SREQISFLVN ETLSTKVRTE QVDKEIHAAI        60
     AALLIPSLVM MAVTLLLSWL AVSWIVRPLN QLQARLEKRS PSNLTPIDID SSMTEITSIT       120
     RTLNHLFSRL QHTLRQERLF TADAAHELRT PLAGVRLHLE LMEQSGVQEA TMLVQRIDQL       180
     MHTVEQLLML SRVGQNFASG HYPQLELINE VVLAQRSELC EMLALRGQHL RLETPSQIPM       240
     HGDAMLLRLM LRNLVENAHR YSPEGSDILL RVTLSTDGHG SILQVIDRGP GIDESRASEL       300
     TEPFHRLDRR FGGSGLGLNI VVRILQLHKG QLTLRNNRPG PGLNACCYLP LTPQDFG          357
//

If you have problems or comments...

PBIL Back to PBIL home page