(data stored in ACNUC7421 zone)

EMBL: CP001600.PE421

CP001600.PE421       Location/Qualifiers
FT   CDS             complement(454276..454938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0454"
FT                   /product="two-component transcriptional regulator protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67692"
FT                   /db_xref="GOA:C5BFA6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA6"
FT                   /protein_id="ACR67692.1"
FT                   /translation="MKILIVEDDTLIQQGLAQAMARENYAYDCADSAVGASALLQSSHY
FT                   SLIILDLGLPDIDGANALRQWRREGIDAPVLILTARDTVSDRVDGLDAGADDYLVKPFA
FT                   LAELLARVRALIRRMQGLCNNFLQVDDIHLDLSSQQVTCGGQALEITPKEFAILARLMM
FT                   RAGQTINREVLQQDLYSWQDGLSSNSLEVHIHNLRRKLGKKRIKTLRGVGYRLEKTQ"
     MKILIVEDDT LIQQGLAQAM ARENYAYDCA DSAVGASALL QSSHYSLIIL DLGLPDIDGA        60
     NALRQWRREG IDAPVLILTA RDTVSDRVDG LDAGADDYLV KPFALAELLA RVRALIRRMQ       120
     GLCNNFLQVD DIHLDLSSQQ VTCGGQALEI TPKEFAILAR LMMRAGQTIN REVLQQDLYS       180
     WQDGLSSNSL EVHIHNLRRK LGKKRIKTLR GVGYRLEKTQ                             220
//

If you have problems or comments...

PBIL Back to PBIL home page