(data stored in ACNUC7421 zone)

EMBL: CP001600.PE424

CP001600.PE424       Location/Qualifiers
FT   CDS             complement(457247..457540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0457"
FT                   /product="conserved hypothetical protein TIGR00253"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67695"
FT                   /db_xref="GOA:C5BFA9"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFA9"
FT                   /protein_id="ACR67695.1"
FT                   /translation="MNLTNKQKQHLKSLAHSLKPVVQLGANGLTEGVLAEIEQALAHHE
FT                   LIKVRIAAEERDTKTLIANAIVRETGAYNVQLIGNILVIYRPSEERKISLPR"
     MNLTNKQKQH LKSLAHSLKP VVQLGANGLT EGVLAEIEQA LAHHELIKVR IAAEERDTKT        60
     LIANAIVRET GAYNVQLIGN ILVIYRPSEE RKISLPR                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page