(data stored in ACNUC7421 zone)

EMBL: CP001600.PE425

CP001600.PE425       Location/Qualifiers
FT   CDS             457671..458297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0458"
FT                   /product="ribosomal RNA large subunit methyltransferase J,
FT                   putative"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67696"
FT                   /db_xref="GOA:C5BFB0"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BFB0"
FT                   /protein_id="ACR67696.1"
FT                   /translation="MGKKRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQGTD
FT                   KIFRPGMTVVDLGAAPGGWSQYVVTQIGDKGRVIACDLLPMDPIVGVDFLQGDFRDELV
FT                   LAALMERVGDAKVQVVMSDMAPNMSGTPSVDIPRAMYLVELAFEMAKDVLAPGGSFVVK
FT                   VFQGEGFDEYLGQIRSLFTKVKIRKPEASRARSREVYIVATGRKL"
     MGKKRSASSS RWLQEHFSDK YVQQAQKKGL RSRAWFKLDE IQGTDKIFRP GMTVVDLGAA        60
     PGGWSQYVVT QIGDKGRVIA CDLLPMDPIV GVDFLQGDFR DELVLAALME RVGDAKVQVV       120
     MSDMAPNMSG TPSVDIPRAM YLVELAFEMA KDVLAPGGSF VVKVFQGEGF DEYLGQIRSL       180
     FTKVKIRKPE ASRARSREVY IVATGRKL                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page