(data stored in ACNUC7421 zone)

EMBL: CP001600.PE429

CP001600.PE429       Location/Qualifiers
FT   CDS             462752..463087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0462"
FT                   /product="preprotein translocase, SecG subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67700"
FT                   /db_xref="GOA:C5BFB4"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFB4"
FT                   /protein_id="ACR67700.1"
FT                   /translation="MYEALLVIFLLISVALIALIMLQQGKGADMGASFGAGASATLFGS
FT                   SGTGNFMTRTTGILATLFFVLSLVLGNLSGHQSKQGSEWDNLGQPMKTEQPAKPAVPAT
FT                   PSSDIPN"
     MYEALLVIFL LISVALIALI MLQQGKGADM GASFGAGASA TLFGSSGTGN FMTRTTGILA        60
     TLFFVLSLVL GNLSGHQSKQ GSEWDNLGQP MKTEQPAKPA VPATPSSDIP N                111
//

If you have problems or comments...

PBIL Back to PBIL home page