(data stored in ACNUC7421 zone)

EMBL: CP001600.PE43

CP001600.PE43        Location/Qualifiers
FT   CDS             39261..41018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0045"
FT                   /product="type I restriction-modification system, S
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67305"
FT                   /db_xref="GOA:C5B9C5"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C5"
FT                   /protein_id="ACR67305.1"
FT                   /translation="MAIENLITDHLDLWTAAVRPKSSAGRGASSKLELTGIKKLRELIL
FT                   ELAVRGKLVSQDPCDEPASVLLERIAAEKARLVKEGKLKKPKALPEISEEEQPFDLPEG
FT                   WAWGSIGYITEFVNGYAFKSSDFASEGVGIVKIGDIQDGEIVVDNMSRVSQHVVDGLNE
FT                   NLQVKSGDMLIAMSGATTGKLGFNKTDEIFYLNQRVGKFITYLVDKEFLYYPLATKIAE
FT                   NLAKAMGSAIPNISTKQINEITIALPPLAEQHRIVAKVDELMALCDQLEQCSESQLAAH
FT                   QTLVEALLATLTDSSDTEELAQNWARLNTHFDTLFTTEASIDALKQTILQLAVMGKLVQ
FT                   QDPSDEPASALLARIAAEKAQLIKEKKIKKEKPLPAISEDEKPFSLPKGWDFAYMQDLC
FT                   YLITDGTHQTPKYTDDGRPFISAQCVKPFRFMPEFCRYVSEEHYQLYIKNRRPEFGDIL
FT                   LSRVGAGIGEAAVIDSCLEFAIYVSTGLLKPNRGAVYSKYLELWLNSPIGRGFSERNTL
FT                   GKGVSQGNLNLSLIRSFIVSLPPKKEQKLIVAKVGEMITLCDQLKSCLQTSQQTQLALA
FT                   ESLVEGAIA"
     MAIENLITDH LDLWTAAVRP KSSAGRGASS KLELTGIKKL RELILELAVR GKLVSQDPCD        60
     EPASVLLERI AAEKARLVKE GKLKKPKALP EISEEEQPFD LPEGWAWGSI GYITEFVNGY       120
     AFKSSDFASE GVGIVKIGDI QDGEIVVDNM SRVSQHVVDG LNENLQVKSG DMLIAMSGAT       180
     TGKLGFNKTD EIFYLNQRVG KFITYLVDKE FLYYPLATKI AENLAKAMGS AIPNISTKQI       240
     NEITIALPPL AEQHRIVAKV DELMALCDQL EQCSESQLAA HQTLVEALLA TLTDSSDTEE       300
     LAQNWARLNT HFDTLFTTEA SIDALKQTIL QLAVMGKLVQ QDPSDEPASA LLARIAAEKA       360
     QLIKEKKIKK EKPLPAISED EKPFSLPKGW DFAYMQDLCY LITDGTHQTP KYTDDGRPFI       420
     SAQCVKPFRF MPEFCRYVSE EHYQLYIKNR RPEFGDILLS RVGAGIGEAA VIDSCLEFAI       480
     YVSTGLLKPN RGAVYSKYLE LWLNSPIGRG FSERNTLGKG VSQGNLNLSL IRSFIVSLPP       540
     KKEQKLIVAK VGEMITLCDQ LKSCLQTSQQ TQLALAESLV EGAIA                       585
//

If you have problems or comments...

PBIL Back to PBIL home page