(data stored in ACNUC7421 zone)

EMBL: CP001600.PE430

CP001600.PE430       Location/Qualifiers
FT   CDS             463606..464028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0465"
FT                   /product="hypothetical protein"
FT                   /note="Uncharacterized BCR, YhbC family COG0779"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67701"
FT                   /db_xref="GOA:C5BFB5"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFB5"
FT                   /protein_id="ACR67701.1"
FT                   /translation="MITAPVEALGFELVGIEFIRGRHSTLRIYIDSEEGITVDNCADVS
FT                   HQVSAVLDVEDPISVAYYLEVSSPGMERPLFIAEHYTRFLNEEVTLVLRMAMQNRRKWQ
FT                   GIIKAVDGEMITVTVDGKDEVFALSNVQKANLVPHF"
     MITAPVEALG FELVGIEFIR GRHSTLRIYI DSEEGITVDN CADVSHQVSA VLDVEDPISV        60
     AYYLEVSSPG MERPLFIAEH YTRFLNEEVT LVLRMAMQNR RKWQGIIKAV DGEMITVTVD       120
     GKDEVFALSN VQKANLVPHF                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page