(data stored in ACNUC7421 zone)

EMBL: CP001600.PE437

CP001600.PE437       Location/Qualifiers
FT   CDS             472638..473522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0473"
FT                   /product="tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67708"
FT                   /db_xref="GOA:C5BFC2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023605"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC2"
FT                   /protein_id="ACR67708.1"
FT                   /translation="MKPILRWCYVATAILLAGCSNADWRQNEVLAIPLQPSLQQEVMLA
FT                   RMEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGI
FT                   YLTQAGNFDAAYEAFDSVLELDPTYSYARLNRGIALYYGGRYSLAQDDLQAFYQDDPND
FT                   PFRSLWLYLAERELNQDQALTALSQRYNKANRSQWGWNIVEFYLGKISEKTLMERLQAD
FT                   ATDNTSLAEHLSETDFYLGKHYLSLGEKSSASALFKLTVANNVHNFVENRYALLELARL
FT                   GQEQDDIPESDQQ"
     MKPILRWCYV ATAILLAGCS NADWRQNEVL AIPLQPSLQQ EVMLARMEQI LASRALTDDE        60
     RAQLLYERGV LYDSLGLRAL ARNDFSQALA IRPDMPEVFN YLGIYLTQAG NFDAAYEAFD       120
     SVLELDPTYS YARLNRGIAL YYGGRYSLAQ DDLQAFYQDD PNDPFRSLWL YLAERELNQD       180
     QALTALSQRY NKANRSQWGW NIVEFYLGKI SEKTLMERLQ ADATDNTSLA EHLSETDFYL       240
     GKHYLSLGEK SSASALFKLT VANNVHNFVE NRYALLELAR LGQEQDDIPE SDQQ             294
//

If you have problems or comments...

PBIL Back to PBIL home page