(data stored in ACNUC7421 zone)

EMBL: CP001600.PE440

CP001600.PE440       Location/Qualifiers
FT   CDS             476178..477509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0476"
FT                   /product="inner membrane transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67711"
FT                   /db_xref="GOA:C5BFC5"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC5"
FT                   /protein_id="ACR67711.2"
FT                   /translation="METTQMSSVILAGHPAVTRDGMSDSEWWAATRFDSTDVGWVMMSI
FT                   GMAIGAGIVFLPVQVGLMGLWVFLLSSVVGYPAMYLFQRLFINTLAESPECRDYPSVIS
FT                   GYLGKNWGILLGGLYFVMLVIWMFVYSTAITNDSASYLHTFGVTEGLLSENPFYGLALI
FT                   CVLVAISSRGEQLLFKLSSFMVLTKLLVVAALGIAMVGMWHLYNVGALPPLGLLVKNAV
FT                   ITLPFTLTSILFIQTLSPMVISYRAHCKSREVARYKALRAMNIAFGVLFVTVFFYAVSF
FT                   TLAMGHDEAVKAYQQNISALAIAAQFIDGGIDNWVTVVSVILNIFAVMTAFFGVYLGFR
FT                   EATQGIVMNLLRRMVPPERIKERWVQGSIMALAVLLAWGAIILNAPVLSFTSICSPIFG
FT                   MVGCLIPAYLVYRVPALHKYKGVSLLVIIITGLLLCISPLLAFF"
     METTQMSSVI LAGHPAVTRD GMSDSEWWAA TRFDSTDVGW VMMSIGMAIG AGIVFLPVQV        60
     GLMGLWVFLL SSVVGYPAMY LFQRLFINTL AESPECRDYP SVISGYLGKN WGILLGGLYF       120
     VMLVIWMFVY STAITNDSAS YLHTFGVTEG LLSENPFYGL ALICVLVAIS SRGEQLLFKL       180
     SSFMVLTKLL VVAALGIAMV GMWHLYNVGA LPPLGLLVKN AVITLPFTLT SILFIQTLSP       240
     MVISYRAHCK SREVARYKAL RAMNIAFGVL FVTVFFYAVS FTLAMGHDEA VKAYQQNISA       300
     LAIAAQFIDG GIDNWVTVVS VILNIFAVMT AFFGVYLGFR EATQGIVMNL LRRMVPPERI       360
     KERWVQGSIM ALAVLLAWGA IILNAPVLSF TSICSPIFGM VGCLIPAYLV YRVPALHKYK       420
     GVSLLVIIIT GLLLCISPLL AFF                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page