(data stored in ACNUC7421 zone)

EMBL: CP001600.PE441

CP001600.PE441       Location/Qualifiers
FT   CDS             477884..478153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67712"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/TrEMBL:C5BFC6"
FT                   /protein_id="ACR67712.1"
FT                   /translation="MGAAVGIAWLIDGRYEVVAMSIGSMSGDVSGMICDGASNSCTMKV
FT                   SISLSAAFKVVLMAQDNSAMSGNERIVAHDVDHSIATCACWPVA"
     MGAAVGIAWL IDGRYEVVAM SIGSMSGDVS GMICDGASNS CTMKVSISLS AAFKVVLMAQ        60
     DNSAMSGNER IVAHDVDHSI ATCACWPVA                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page