(data stored in ACNUC7421 zone)

EMBL: CP001600.PE448

CP001600.PE448       Location/Qualifiers
FT   CDS             483822..484277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0484"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67719"
FT                   /db_xref="GOA:C5BH36"
FT                   /db_xref="InterPro:IPR011194"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH36"
FT                   /protein_id="ACR67719.1"
FT                   /translation="MINDDTLAAIRRFLTRQHVVTLAVGQGETLWCADCFYALDALPMT
FT                   LYLLTSPTSHHGRLMSANPRVAGTVAHQTRSVAKIQGIQFHGRIACLDGEDAAVAYAAY
FT                   YRRFPLARARPSPVWGLHLMRVKMTDNTCGFGHKRHWAREGEPVGVY"
     MINDDTLAAI RRFLTRQHVV TLAVGQGETL WCADCFYALD ALPMTLYLLT SPTSHHGRLM        60
     SANPRVAGTV AHQTRSVAKI QGIQFHGRIA CLDGEDAAVA YAAYYRRFPL ARARPSPVWG       120
     LHLMRVKMTD NTCGFGHKRH WAREGEPVGV Y                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page