(data stored in ACNUC7421 zone)

EMBL: CP001600.PE449

CP001600.PE449       Location/Qualifiers
FT   CDS             484373..485023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0485"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67720"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH37"
FT                   /protein_id="ACR67720.1"
FT                   /translation="MYVLLLGATGLIGRALLTLLASDPRVTQIYAPTRTALPASDKLIN
FT                   PVGADICRAMLDWDTPCDVAFCCLGTTRKAAGSDSNFRYVDYSLVVECGAVALQHGCRH
FT                   YVVVSALGANAQSPFLFSRTKGEMEQALELQAWRRLSLLRPSLLQGERAKPRLLEQISE
FT                   PLFRLLPEKWKAIEADCVARAMLRCALYPAEYRLQILESEQVQRLGETVAGAL"
     MYVLLLGATG LIGRALLTLL ASDPRVTQIY APTRTALPAS DKLINPVGAD ICRAMLDWDT        60
     PCDVAFCCLG TTRKAAGSDS NFRYVDYSLV VECGAVALQH GCRHYVVVSA LGANAQSPFL       120
     FSRTKGEMEQ ALELQAWRRL SLLRPSLLQG ERAKPRLLEQ ISEPLFRLLP EKWKAIEADC       180
     VARAMLRCAL YPAEYRLQIL ESEQVQRLGE TVAGAL                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page