(data stored in ACNUC7421 zone)

EMBL: CP001600.PE45

CP001600.PE45        Location/Qualifiers
FT   CDS             42432..43418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0047"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67307"
FT                   /db_xref="GOA:C5B9C7"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C7"
FT                   /protein_id="ACR67307.1"
FT                   /translation="MTLFHIANQQLTPLTQTTFAAEGLQERQDLQEALKRNIAVIAPDC
FT                   LVIADEFSDWEDSRRRIDLLAIDRNANLVVIELKRNEVGAHMELQALRYAAMITNMTFD
FT                   KACEYFAAYIEQEGLQIDARNTLLEFVDLDENQLDDFGNEVRIVLASADFGKELTTSVL
FT                   WLRDKGIDIRCVRLTPFRYQGEVLINAAQIIPLEEAESYQIQFREKRAEQRASQQGTRD
FT                   YSKYRFNGGVYNKRHFALAVLSHWIKDRQLADLAEITAYLAQFDLPRKVTPVDQIPEKN
FT                   LNRWHLGEGNLIELPSGEQIAISNQWGTDTERLLQGMTQLGYQIEKI"
     MTLFHIANQQ LTPLTQTTFA AEGLQERQDL QEALKRNIAV IAPDCLVIAD EFSDWEDSRR        60
     RIDLLAIDRN ANLVVIELKR NEVGAHMELQ ALRYAAMITN MTFDKACEYF AAYIEQEGLQ       120
     IDARNTLLEF VDLDENQLDD FGNEVRIVLA SADFGKELTT SVLWLRDKGI DIRCVRLTPF       180
     RYQGEVLINA AQIIPLEEAE SYQIQFREKR AEQRASQQGT RDYSKYRFNG GVYNKRHFAL       240
     AVLSHWIKDR QLADLAEITA YLAQFDLPRK VTPVDQIPEK NLNRWHLGEG NLIELPSGEQ       300
     IAISNQWGTD TERLLQGMTQ LGYQIEKI                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page