(data stored in ACNUC7421 zone)

EMBL: CP001600.PE453

CP001600.PE453       Location/Qualifiers
FT   CDS             complement(488137..488424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0489"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67724"
FT                   /db_xref="InterPro:IPR025612"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH41"
FT                   /protein_id="ACR67724.1"
FT                   /translation="MNHQRQTLAAEKARLLQKIAQQRLDLHTESLCAERLCINVDRTLT
FT                   TLWRLRRSLSLAAGLAVVYAARHPSRLPGGIKQAVGLWSTLRLARRMFYP"
     MNHQRQTLAA EKARLLQKIA QQRLDLHTES LCAERLCINV DRTLTTLWRL RRSLSLAAGL        60
     AVVYAARHPS RLPGGIKQAV GLWSTLRLAR RMFYP                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page