(data stored in ACNUC7421 zone)

EMBL: CP001600.PE454

CP001600.PE454       Location/Qualifiers
FT   CDS             complement(488421..488825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0490"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67725"
FT                   /db_xref="GOA:C5BH42"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH42"
FT                   /protein_id="ACR67725.1"
FT                   /translation="MPGDTSPSQGSASGILGTARRIVTLLLGMTETRLRLAVVELEEER
FT                   ANLIQLLLMAGITLLFTAFGLMCLLVLLFLAVEPTYRLMALGIATALLLLLACVGAIWT
FT                   LIKARRSTFLLATRKQLEIDRQLLERREKP"
     MPGDTSPSQG SASGILGTAR RIVTLLLGMT ETRLRLAVVE LEEERANLIQ LLLMAGITLL        60
     FTAFGLMCLL VLLFLAVEPT YRLMALGIAT ALLLLLACVG AIWTLIKARR STFLLATRKQ       120
     LEIDRQLLER REKP                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page