(data stored in ACNUC7421 zone)

EMBL: CP001600.PE455

CP001600.PE455       Location/Qualifiers
FT   CDS             complement(488825..489130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0491"
FT                   /product="Bacterial protein of unknown function (DUF883)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67726"
FT                   /db_xref="GOA:C5BH43"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH43"
FT                   /protein_id="ACR67726.1"
FT                   /translation="MTNDSTAEHLRAELKSLADALEDVLNSSTDKPKAELEKLRARAHD
FT                   ALHNSRERLSQAGESVATQTREMAGRADDYVRDNPWTGVGIGAAVGIVLGVLLARR"
     MTNDSTAEHL RAELKSLADA LEDVLNSSTD KPKAELEKLR ARAHDALHNS RERLSQAGES        60
     VATQTREMAG RADDYVRDNP WTGVGIGAAV GIVLGVLLAR R                           101
//

If you have problems or comments...

PBIL Back to PBIL home page