(data stored in ACNUC7421 zone)

EMBL: CP001600.PE456

CP001600.PE456       Location/Qualifiers
FT   CDS             complement(489403..489819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0492"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67727"
FT                   /db_xref="GOA:C5BH44"
FT                   /db_xref="InterPro:IPR026574"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5BH44"
FT                   /protein_id="ACR67727.1"
FT                   /translation="MNQANSQPFTRRQGWKRILGLLLFIVAALTVVILPQLGHKEVSLQ
FT                   IRATHNGLATPDGFFVYQKLDENGVSITSITQDREGLVIRLAHPEQRTLALQVLQRELP
FT                   PGYSIADKILHRSLFYKSERPAAATLSYSAGHNR"
     MNQANSQPFT RRQGWKRILG LLLFIVAALT VVILPQLGHK EVSLQIRATH NGLATPDGFF        60
     VYQKLDENGV SITSITQDRE GLVIRLAHPE QRTLALQVLQ RELPPGYSIA DKILHRSLFY       120
     KSERPAAATL SYSAGHNR                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page