(data stored in ACNUC7421 zone)

EMBL: CP001600.PE457

CP001600.PE457       Location/Qualifiers
FT   CDS             complement(489821..490501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0493"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67728"
FT                   /db_xref="GOA:C5BH45"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH45"
FT                   /protein_id="ACR67728.1"
FT                   /translation="MDIIRELITALWHQDYETLANPSLVWTIYGILFMILFLENGLLPA
FT                   AFLPGDSLLILVGVLIARDTMDFPLTLLVLTSAASLGCWVGYLQGRWLGNTHLVQKWLS
FT                   HLPAHYHQRAHQLFHRHGLAALLIGRFLAFVRTLLPLIAGLSGLSAPRFQFFNWVSGLL
FT                   WVLILSTLGYVLGKTPLFLRYEDQLMNLLMLLPLVLLVFGLCGSLLVLWRKKHAHATDK
FT                   SPRK"
     MDIIRELITA LWHQDYETLA NPSLVWTIYG ILFMILFLEN GLLPAAFLPG DSLLILVGVL        60
     IARDTMDFPL TLLVLTSAAS LGCWVGYLQG RWLGNTHLVQ KWLSHLPAHY HQRAHQLFHR       120
     HGLAALLIGR FLAFVRTLLP LIAGLSGLSA PRFQFFNWVS GLLWVLILST LGYVLGKTPL       180
     FLRYEDQLMN LLMLLPLVLL VFGLCGSLLV LWRKKHAHAT DKSPRK                      226
//

If you have problems or comments...

PBIL Back to PBIL home page