(data stored in ACNUC7421 zone)

EMBL: CP001600.PE458

CP001600.PE458       Location/Qualifiers
FT   CDS             complement(490602..491129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0494"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67729"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH46"
FT                   /protein_id="ACR67729.1"
FT                   /translation="MWAILLKWTPIFLSVSGNDKILKRVTSASLLLLLFCWAATAIGKI
FT                   GAWHSQVITTLPLNQLPCNTAIFSEDDRNPAGGHCLSRIPHNRKITALIRLHICGGSEV
FT                   ARNGLVPPDVPPPESRQPYPPQAPGNDGHYARLSRILLRTLQLPPHQNRLGGWKESNIL
FT                   YRGQVTYHPTLA"
     MWAILLKWTP IFLSVSGNDK ILKRVTSASL LLLLFCWAAT AIGKIGAWHS QVITTLPLNQ        60
     LPCNTAIFSE DDRNPAGGHC LSRIPHNRKI TALIRLHICG GSEVARNGLV PPDVPPPESR       120
     QPYPPQAPGN DGHYARLSRI LLRTLQLPPH QNRLGGWKES NILYRGQVTY HPTLA            175
//

If you have problems or comments...

PBIL Back to PBIL home page