(data stored in ACNUC7421 zone)

EMBL: CP001600.PE459

CP001600.PE459       Location/Qualifiers
FT   CDS             complement(491258..491647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0495"
FT                   /product="crcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67730"
FT                   /db_xref="GOA:C5BH47"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C5BH47"
FT                   /protein_id="ACR67730.1"
FT                   /translation="MNYGLTLLVVACGGALGAISRFQITNWFSSWFGDGFPYATLTVNV
FT                   IGCFIMGALVSMLNSGTLIAPHWRPLIGVGFLGALTTFSTFSFDTFALFSEGFWVKAML
FT                   NVVLNLILCMAAVSAGYYLLLSRSA"
     MNYGLTLLVV ACGGALGAIS RFQITNWFSS WFGDGFPYAT LTVNVIGCFI MGALVSMLNS        60
     GTLIAPHWRP LIGVGFLGAL TTFSTFSFDT FALFSEGFWV KAMLNVVLNL ILCMAAVSAG       120
     YYLLLSRSA                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page