(data stored in ACNUC7421 zone)

EMBL: CP001600.PE46

CP001600.PE46        Location/Qualifiers
FT   CDS             complement(44070..44933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0048"
FT                   /product="conserved hypothetical protein TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67308"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:C5B9C8"
FT                   /protein_id="ACR67308.1"
FT                   /translation="MIRSMTAYARREVKGNWGSAAWELRSVNQRYLETYIRLPEQFRSL
FT                   EPVIRERLRTRLTRGKVECNLRFELDPSAQSALILNESLAKQLVDAANWVKLQSDEGEI
FT                   NPLDVLRWPGVMAAAEQDLDAISSELLGALDSTIDDFIDAREREGSALKQLIEQRLEAV
FT                   STEVAKVRSRMPEILQWQRERLLSKLEEAQVQLENNRLEQELVLMAQRIDVAEELDRLD
FT                   AHVKETYVILKKKEAVGRRLDFMMQEFNRESNTLASKSINADITASAIELKVLIEQMRE
FT                   QIQNIE"
     MIRSMTAYAR REVKGNWGSA AWELRSVNQR YLETYIRLPE QFRSLEPVIR ERLRTRLTRG        60
     KVECNLRFEL DPSAQSALIL NESLAKQLVD AANWVKLQSD EGEINPLDVL RWPGVMAAAE       120
     QDLDAISSEL LGALDSTIDD FIDAREREGS ALKQLIEQRL EAVSTEVAKV RSRMPEILQW       180
     QRERLLSKLE EAQVQLENNR LEQELVLMAQ RIDVAEELDR LDAHVKETYV ILKKKEAVGR       240
     RLDFMMQEFN RESNTLASKS INADITASAI ELKVLIEQMR EQIQNIE                     287
//

If you have problems or comments...

PBIL Back to PBIL home page